Recombinant Epstein-Barr Virus Secreted Protein Barf1 (BARF1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01768P
Greater than 90% as determined by SDS-PAGE.
Recombinant Epstein-Barr Virus Secreted Protein Barf1 (BARF1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01768P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Epstein-Barr Virus Secreted Protein Barf1 (BARF1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0CW72 |
| Target Symbol | BARF1 |
| Synonyms | 33 kDa early protein p33 |
| Species | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ |
| Expression Range | 21-221aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 28.4 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays diverse functions in immunomodulation and oncogenicity, maybe by acting as a functional receptor for human CSF1. May inhibit interferon secretion from mononuclear cells. Exhibits oncogenic activity in vitro. |
| Subcellular Location | Secreted. |
| Database References | KEGG: vg:3783772 |
Gene Functions References
- Epstein Barr virus-encoded BARF1 promotes cell proliferation in stomach cancer by upregulating NFkappaB and miR-146a and downregulating SMAD4, thereby contributing to EBV-induced stomach cancer progression. PMID: 27438138
- siRNA-mediated BARF1 down-regulation induces caspase-dependent apoptosis via the mitochondrial pathway through modulation of Bcl-2/BAX ratio in AG876 and Hone-Akata cells. PMID: 25740140
- In BARF1-transfected cells, cell growth was activated and its protein was found both in culture medium and cellular compartment (membrane, cytoplasm and nuclei). PMID: 23458996
- These results indicate that BARF1 blockade of CSF-1 signaling is an important immune evasion strategy for efficient acute EBV infection and a significant determinant for virus setpoint during persistent EBV infection. PMID: 23300447
- M-CSF was shown to interact with Epstein-Barr virus-encoded BARF1 via the protruding N-terminal loops involving Val38 and Ala84. PMID: 23061794
- Studies indicate that BARF1 is expressed as a latent gene in nasopharyngeal carcinoma (NPC), and that BARF1 contributes to the tumorigenicity of NPC cells. PMID: 22210180
- The N- and O-glycans were partially characterized and it was demonstrated that both modifications are required for active secretion of the BARF1 protein via the classical pathway. PMID: 17872516
