Recombinant Epstein-Barr Virus Latent Membrane Protein 2 (LMP2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03513P

Greater than 90% as determined by SDS-PAGE.
Recombinant Epstein-Barr Virus Latent Membrane Protein 2 (LMP2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03513P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Epstein-Barr Virus Latent Membrane Protein 2 (LMP2) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P13285 |
Target Symbol | LMP2 |
Synonyms | LMP2; Latent membrane protein 2; Terminal protein |
Species | Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS |
Expression Range | 1-147aa |
Protein Length | Partial |
Mol. Weight | 31.6kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs.; Isoform LMP2B may be a negative regulator of isoform LMP2A. |
Subcellular Location | [Isoform LMP2A]: Host cell membrane; Multi-pass membrane protein.; [Isoform LMP2B]: Host endomembrane system; Multi-pass membrane protein. Host cytoplasm, host perinuclear region. |
Protein Families | Herpesviridae LMP-2 family |
Database References | KEGG: vg:3783751 |
Gene Functions References
- In EBV-positive Hodgkin's lymphoma LMP2A-expressing HRS cells lacking BCR signalling functions cannot induce EGR1 and are consequently protected from entry to the virus lytic cycle. PMID: 23592216
- Epstein-Barr virus latent membrane protein 2A contributes to anoikis resistance through ERK activation. PMID: 23698301
- LMP2A, but not LMP2B, is critical for efficient long-term growth of B cells in vitro. PMID: 23308294
- LMP2A plays a role in the alteration of a cytokine that is important for both tumour survival and anti-tumour responses. PMID: 23303827
- LMP2A can affect a number of signaling pathways by regulating the phosphorylation of the ITSN1 and Shb adaptors. PMID: 22975684
- Data show that LMP2A enhances antigen presentation function. PMID: 22616025
- hnRNP K, when co-expressed with EBNA2, strongly enhances viral latent membrane protein 2A (LMP2A) expression. PMID: 22879910
- Epstein-Barr virus latent membrane protein-2A induces ITAM/Syk- and Akt-dependent epithelial migration through alphav-integrin membrane translocation PMID: 22837212
- Fra-1 was induced by Epstein-Barr virus LMP2A and is essential for LMP2A-triggered MMP9 expression. PMID: 22514348
- Widespread sequence variations in the LMP2A gene were found PMID: 22470549
- Studies suggest that LMP2A can also participate in EBV-induced epithelial cell growth transformation. PMID: 22249143
- EBV LMP2A is expressed in nasopharyngeal cancer. Cases with nasopharyngeal inflammation showed negative expression of LMP2A. PMID: 16124641
- Results confirmed that HPV L1 protein is potential to deliver multiepitope of EBV LMP2 as immunogen. PMID: 20705592
- LMP2A induces an epithelial-mesenchymal transition and increases the number of side population stem-like cancer cells in nasopharyngeal carcinoma. PMID: 20532215
- LMP2A uniquely makes resting B-cells sensitive to NF-kappaB inhibition and apoptosis and suggest that NF-kappaB may be a novel target to eradicate latently EBV-infected B-cells. PMID: 20484564
- LMP2A induces a heightened sensitivity to TLR ligand stimulation PMID: 16920914
- Expression of the EBV genes for latent membrane protein 1 and latent membrane protein 2A decreases FoxO1 expression.[LMP-2A] PMID: 16943287
- Phosphorylation of LMP2A is prevented by LMP2B. PMID: 17035319
- results indicate that cholesterol-dependent LMP2A trafficking determines the fate of LMP2A degradation PMID: 17150237
- The signalling scaffold Shb associates through SH2 and PTB domain interactions with phosphorylated tyrosine motifs in the LMP2A N-terminal tail. PMID: 17311000
- These results suggest that constitutive activation of the Ras/PI3-K/Akt pathway by LMP2A is a key factor for LMP2A-mediated transformation. PMID: 17582000
- All isolates from 7 Japanese nasal NK/T cell lymphomas showed the same amino acid change from serine to threonine at codon 348 in the CTL epitope SSCSSCPLSK of LMP2A. PMID: 17657160
- A role for LMP2A as an indispensable BCR mimic in certain B cells from which human B-cell tumors such as Hodgkin lymphoma originate. PMID: 17682125
- The results suggest that the combinatorial effects of DNA methylation, histone acetylation, and H3K4me2 modulate the activity of LMP2A promoter. PMID: 17898065
- These results demonstrate that LMP2A activates the Notch pathway in both B cells and epithelial cells, and exploits this pathway to regulate its own expresison. PMID: 17980397
- EBV uses its latent protein, LMP2A, to activate the NF-kappaB-survivin pathway to rescue EBV-infected epithelial cells from serum deprivation PMID: 18316606
- Despite the lack of pre-BCR expression, bone marrow B cells from TgE LMP2A mice proliferate and survive in low concentrations of interleukin 7, similar to wild-type cells. PMID: 18559925
- This demonstrates that the UGDH transcript and protein quantities, the enzyme activity, and glycosaminoglycan contents increase in LMP2A overexpressed human embryonic kidney 293 (HEK293) cells. PMID: 18717819
- LMP2A and the Notch1 pathway may cooperate to induce the alterations in B-cell identity seen in Hodgkin Reed-Sternberg cells PMID: 18815281
- LMP2B modulates the activity of LMP2A contributing to maintenance of Epstein-Barr virus latency. PMID: 18835714
- the immunoreceptor tyrosine-based activation motif (ITAM) of LMP-2A is important for HERV-K18 env transactivation PMID: 19070345
- c-Cbl promoted LMP2A degradation through ubiquitination, specifically degraded the Syk protein tyrosine kinase in the presence of LMP2A, and inhibited LMP2A induction of the EBV lytic cycle PMID: 19081591
- EBV LMP2A promotes tumor development by protecting pre-tumor B cells that would normally apoptose after the c-myc translocation. PMID: 19182823
- LMP2A can permit tumorigenesis in the presence of an intact p53 pathway, identifying an important contribution of EBV to Burkitt's lymphoma PMID: 19815507
- Our findings emphasize the role of miR-BART22 in modulating LMP2A expression PMID: 19881953