Recombinant Epstein-Barr Virus Epstein-Barr Nuclear Antigen 3 (EBNA3) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00752P
Greater than 90% as determined by SDS-PAGE.
Recombinant Epstein-Barr Virus Epstein-Barr Nuclear Antigen 3 (EBNA3) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00752P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Epstein-Barr Virus Epstein-Barr Nuclear Antigen 3 (EBNA3) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q3KST2 |
| Target Symbol | EBNA3 |
| Synonyms | (EBNA-3)(EBV nuclear antigen 3)(Epstein-Barr nuclear antigen 3A)(EBNA-3A)(EBV nuclear antigen 3A) |
| Species | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MDKDRPGDPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAQLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA |
| Expression Range | 1-138aa |
| Protein Length | Partial |
| Mol. Weight | 22.6 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop. |
| Subcellular Location | Host nucleus matrix. |
| Protein Families | Herpesviridae EBNA-3 family |
