Recombinant Enterobacteria Phage T4 Endolysin (E) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03841P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) E.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) E.
Recombinant Enterobacteria Phage T4 Endolysin (E) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03841P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Enterobacteria Phage T4 Endolysin (E) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P00720 |
| Target Symbol | E |
| Synonyms | E; Endolysin; EC 3.2.1.17; Lysis protein; Lysozyme; Muramidase |
| Species | Enterobacteria phage T4 (Bacteriophage T4) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL |
| Expression Range | 1-164aa |
| Protein Length | Full Length |
| Mol. Weight | 34.6kDa |
| Research Area | Microbiology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Endolysin with lysozyme activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the peptidoglycan layer. |
| Subcellular Location | Host cytoplasm. |
| Protein Families | Glycosyl hydrolase 24 family |
| Database References | KEGG: vg:1258585 |
Gene Functions References
- Cryoelectron microscopy analysis of small heat shock protein 16.5 (Hsp16.5) complexes with T4 lysozyme reveals the structural basis of multimode binding PMID: 23277356
- Data indicate that the N-terminal fused T4 lysozyme (T4L) is sufficiently rigid relative to the beta(2) adrenergic receptor (beta(2)AR) to facilitate crystallogenesis. PMID: 23056231
