Recombinant E.Coli Signal Peptidase I (LEPB) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04171P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant E.Coli Signal Peptidase I (LEPB) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04171P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant E.Coli Signal Peptidase I (LEPB) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P00803
Target Symbol LEPB
Synonyms lepB; b2568; JW2552; Signal peptidase I; SPase I; EC 3.4.21.89; Leader peptidase I
Species Escherichia coli (strain K12)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Expression Range 78-324aa
Protein Length Partial
Mol. Weight 43.7kDa
Research Area Microbiology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location Cell inner membrane; Multi-pass membrane protein.
Protein Families Peptidase S26 family
Database References

Gene Functions References

  1. LepB promote the association of the central domain of colicin D with the inner membrane and translocation of the toxic tRNase domain into the cytoplasm. PMID: 26499796
  2. Ile-144 and Ile-86 contribute to the signal peptidase substrate specificity and Ile-144 is important for the accuracy of the cleavage reaction PMID: 15598653
  3. Ile-144 and Ile-86 are key P3 substrate specificity determinants for signal peptidase I PMID: 17077081
  4. A thorough investigation of different roles of Escherichia coli type I signal peptidase residues binding to lipopeptide inhibitor has been performed by a combination of computational alanine scanning mutagenesis and free energy decomposition methods. PMID: 17532654

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from All Products
Tn5 Transposase
  • Expression system: E.coli;
CAT#: TN5-BL01
Sale
SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
  • Molecule: SHFL;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His+sumo;
  • Sequence: 1-291;
CAT#: BLT-08873P

Save $50
Sale
SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
  • Molecule: NDUFV1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His+SUMO;
  • Sequence: 21-464aa;
CAT#: BLT-08321P

Save $50
Sale
SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
Human NEU2 (Sialidase-2) - Recombinant Protein
  • Molecule: NEU2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His;
  • Sequence: 1-380aa;
CAT#: BLT-08142P

Save $50
Sale
SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
  • Molecule: CEBPB;
  • Species: Mouse;
  • Expression system: E.coli;
  • Tag: N-His-GST;
  • Sequence: 1-296aa;
CAT#: BLT-08014P

Save $50
Sale
SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
  • Molecule: BAX;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His;
  • Sequence: 1-171aa;
CAT#: BLT-07419P

Save $50
Recently viewed