Recombinant E.Coli Ribonuclease E (RNE) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06801P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Ribonuclease E (RNE) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06801P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Ribonuclease E (RNE) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P21513 |
| Target Symbol | RNE |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | EQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS |
| Expression Range | 35-125aa |
| Protein Length | Partial |
| Mol. Weight | 16.1 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Endoribonuclease that plays a central role in RNA processing and decay. Required for the maturation of 5S and 16S rRNAs and the majority of tRNAs. Also involved in the degradation of most mRNAs. Can also process other RNA species, such as RNAI, a molecule that controls the replication of ColE1 plasmid, and the cell division inhibitor DicF-RNA. It initiates the decay of RNAs by cutting them internally near their 5'-end. It is able to remove poly(A) tails by an endonucleolytic process. Required to initiate rRNA degradation during both starvation and quality control; acts after RNase PH (rph) exonucleolytically digests the 3'-end of the 16S rRNA. Degradation of 16S rRNA leads to 23S rRNA degradation. Processes the 3 tRNA(Pro) precursors immediately after the 3'-CCA to generate the mature ends.; Prefers 5'-monophosphorylated substrates over 5'-triphosphorylated substrates. 5'-monophosphate-assisted cleavage requires at least 2 and preferably 3 or more unpaired 5'-terminal nucleotides. The optimal spacing between the 5' end and the scissile phosphate appears to be 8 nucleotides. Any sequence of unpaired nucleotides at the 5'-end is tolerated. |
| Subcellular Location | Cytoplasm. Cell inner membrane; Peripheral membrane protein; Cytoplasmic side. |
| Protein Families | RNase E/G family, RNase E subfamily |
| Database References | KEGG: ecj:JW1071 STRING: 316385.ECDH10B_1155 |
Gene Functions References
- This study suggests that, rather than its role in the processing of any one particular substrate, its distributed functions on all the different substrates (mRNA, rRNA, and tRNA) are responsible for the essentiality of RNase E in E. coli. PMID: 28167522
- Small RNAs processing and Hfq binding determinants for RNase E: RNase E cleaves any RNA fused to the 3' end. PMID: 26531825
- bacteria producing RNase E, have nutritional requirements different from those of cells supplied with only the N-terminal catalytic region of RNase E and mitigation of RNase E deficiency by overexpression of RNase G, is also affected by carbon source. PMID: 23275245
- Electrostatic potentials of were found to be conserved, highly positive, and spread over a large surface area encompassing four putative membrane-binding regions identified in the "large" domain. PMID: 22509045
- Strains harbouring rne alleles that express variants of RNase E in which 5' sensing or direct entry are inactivated, are viable. PMID: 22074454
- Increased abundance of R-loops in the rho and nusG mutants contributes to rescue the lethality associated with loss of the two RNase E cleavage pathways. PMID: 22026368
- demonstrated that CsdA, whose expression is induced by cold shock, interacts physically and functionally with RNase E PMID: 15554978
- The RNase E tetramer has two nonequivalent subunit interfaces, one of which is mediated by a single, tetrathiol-zinc complex; one or both interfaces organize the active site, which is distinct from the primary site of RNA binding. PMID: 15779893
- Observed role of RNase E in sodB mRNA turnover. PMID: 15781494
- crystal structures of the catalytic domain of RNase E as trapped allosteric intermediates with RNA substrates PMID: 16237448
- RNase E is required for induction of the glutamate-dependent acid resistance system in a RpoS-independent manner PMID: 17213667
- RNaseE and the other constituents of the RNA degradosome are components of the bacterial cytoskeleton PMID: 17242352
- This paper demonstrated that RNase E, a key endonuclease responsible for mRNA degradation in E. coli, regulates cspE transcript stability, possibly through the assembly of a degradosome. PMID: 18177308
- RNaseE and RNA helicase B play central roles in the cytoskeletal organization of the RNA degradosome PMID: 18337249
- RraA and RraB have a conserved property to directly act on RNAse E-related enzymes and inhibit their ribonucleolytic activity. PMID: 18510556
- Study shows that the arginine-rich RNA binding domain (ARRBD) of RNase E is important for the initial endoribonucleolytic cleavage of RNAI but dispensable for the endoribonucleolytic cleavages of the Rep mRNA. PMID: 19426759
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
