Recombinant E.Coli Recombination Protein Recr (RECR) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02640P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Recombination Protein Recr (RECR) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02640P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Recombination Protein Recr (RECR) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0A7H6 |
| Target Symbol | RECR |
| Synonyms | recR; b0472; JW0461; Recombination protein RecR |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF |
| Expression Range | 1-201aa |
| Protein Length | Full Length |
| Mol. Weight | 38.0kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO. |
| Protein Families | RecR family |
| Database References | KEGG: ecj:JW0461 STRING: 316385.ECDH10B_0428 |
Gene Functions References
- RecOR, and possibly other SSB-interacting proteins, function(s) in part to alter long-range, macroscopic interactions between or throughout nucleoprotein complexes by microscopically altering wrapping and bridging distant sites. PMID: 26381353
- genetic analysis of recombination in a recB recD double mutant was performed; results show that conjugational recombination and DNA repair in this mutant are highly dependent on recJ, partially dependent on recFOR, and independent of recQ PMID: 15687199
- All three recombination mediator proteins RecFOR are needed to build a functionally competent RecA filament that supports efficient Pol V-mediated translesion synthesis in the presence of ssDNA-binding protein. PMID: 17139245
- When an SSB variant that lacks the C-terminal 8 amino acids is used, the capacity of RecOR to facilitate RecA loading onto the ssDNA is largely abolished PMID: 17272275
- Data show that UvrD and UvrD252 counteract RecQ, RecJ, and RecFOR at forks blocked in the rep mutant of Escherichia coli. PMID: 18567657
