Recombinant E.Coli Probable Diguanylate Cyclase Dgcq (DGCQ) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08379P

Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Probable Diguanylate Cyclase Dgcq (DGCQ) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08379P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant E.Coli Probable Diguanylate Cyclase Dgcq (DGCQ) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P76330 |
Target Symbol | DGCQ |
Synonyms | dgcQ; yedQ; b1956; JW5832; Probable diguanylate cyclase DgcQ; DGC; EC 2.7.7.65; Cellulose synthesis regulatory protein |
Species | Escherichia coli (strain K12) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA |
Expression Range | 381-564aa |
Protein Length | Partial |
Mol. Weight | 47.5kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Catalyzes the synthesis of cyclic-di-GMP (c-di-GMP) via the condensation of 2 GTP molecules. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria. Involved in the regulation of cellulose production. |
Subcellular Location | Cell inner membrane; Multi-pass membrane protein. |
Database References | KEGG: ecj:JW5832 STRING: 316385.ECDH10B_2098 |
Gene Functions References
- DgcQ (YedQ) diguanylate cyclase enzymatic activity is enhanced by Uridine Triphosphate, whilst being inhibited by N-carbamoyl-aspartate, an intermediate of the de novo pathway. PMID: 28892259