Recombinant E.Coli Peptidyl-Lysine N-Acetyltransferase Patz (PATZ) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00607P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Peptidyl-Lysine N-Acetyltransferase Patz (PATZ) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00607P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Peptidyl-Lysine N-Acetyltransferase Patz (PATZ) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P76594 |
| Target Symbol | PATZ |
| Synonyms | (Protein lysine acetyltransferase) |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | ERCLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLANMTQIDYDREMAFVAVRRIDQTEEILGVTRAISDPDNIDAEFAVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFNVDIQLEEGIVGLTLNLAQREES |
| Expression Range | 724-886aa |
| Protein Length | Partial |
| Mol. Weight | 26.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Catalyzes the acetyl-CoA-dependent acetylation of lysine residues of a large number of target proteins. Acetylates RNase R in exponential phase cells and RNase II. Required for the glucose-dependent acetylation on multiple lysines of alpha, beta and beta' RNAP subunits. Also acetylates acetyl-coenzyme A synthetase (Acs) and the chromosomal replication initiator protein DnaA, and inhibits their activity. Overexpression leads to the acetylation of a large number of additional proteins and inhibits motility. |
| Protein Families | Acetate CoA ligase alpha subunit family; Acetate CoA ligase beta subunit family |
| Database References | KEGG: ecj:JW2568 STRING: 316385.ECDH10B_2752 |
Gene Functions References
- The authors present evidence that the transcription of the Gcn5-like acetyltransferase YfiQ of Escherichia coli (proposed name: PatZ) is regulated by cAMP-CRP and its implications on acetate metabolism regulation. PMID: 22059728
- We determined that K298 of RNA polymerase alpha is acetylated in a glucose and YfiQ-dependent manner. PMID: 21696463
- These data indicate that RNase R stability depends on Pka, which itself is regulated under stress conditions. PMID: 22124017
