Recombinant E.Coli Penicillin-Binding Protein 1B (MRCB) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02652P
Greater than 85% as determined by SDS-PAGE.
Recombinant E.Coli Penicillin-Binding Protein 1B (MRCB) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02652P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Penicillin-Binding Protein 1B (MRCB) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P02919 |
| Target Symbol | MRCB |
| Synonyms | mrcB; pbpF; ponB; b0149; JW0145; Penicillin-binding protein 1B; PBP-1b; PBP1b; Murein polymerase) [Includes: Penicillin-insensitive transglycosylase; EC 2.4.1.129; Peptidoglycan TGase; Peptidoglycan glycosyltransferase); Penicillin-sensitive transpeptidase; EC 3.4.16.4; DD-transpeptidase)] |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGA |
| Expression Range | 444-736aa |
| Protein Length | Partial |
| Mol. Weight | 38.6 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). |
| Subcellular Location | Cell inner membrane; Single-pass type II membrane protein. |
| Protein Families | Glycosyltransferase 51 family; Transpeptidase family |
| Database References | KEGG: ecj:JW0145 STRING: 316385.ECDH10B_0129 |
Gene Functions References
- crystal structures of E. coli PBP1b bound to multiple different beta-lactams in the transpeptidase active site and complement these data with gel-based competition assays to provide a detailed structural understanding of its inhibition. Taken together, these biochemical and structural data allow us to propose new insights into inhibition of both enzymatic domains in PBP1b. PMID: 27899450
- findings show that PBP1b is vital for competitive survival of E. coli during extended stationary phase; loss of PBP1b leads to the stationary phase-specific competition defective phenotype and causes cells to become more sensitive to osmotic stress PMID: 16958852
- the X-ray crystal structure of the bifunctional transglycosylase penicillin-binding protein 1b (PBP1b) from Escherichia coli in complex with its inhibitor moenomycin to 2.16-A resolution was determined. PMID: 19458048
