Recombinant E.Coli Nucleoside-Specific Channel-Forming Protein Tsx (TSX) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00156P

Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Nucleoside-Specific Channel-Forming Protein Tsx (TSX) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00156P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant E.Coli Nucleoside-Specific Channel-Forming Protein Tsx (TSX) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Activity | Not tested. |
Uniprotkb | P0A927 |
Target Symbol | TSX |
Species | Escherichia coli (strain K12) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | AENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF |
Expression Range | 23-294aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 38.9 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Functions as substrate-specific channel for nucleosides and deoxynucleosides. Has a greater affinity for deoxynucleosides than for nucleosides, and does not transport free bases. In addition, constitutes the receptor for colicin K and phage T6.; (Microbial infection) Serves as a receptor for CdiA-STECO31, required for adhesion between E.coli expressing CdiA-STECO31 and this strain. |
Subcellular Location | Cell outer membrane; Multi-pass membrane protein. |
Protein Families | Nucleoside-specific channel-forming outer membrane porin (Tsx) (TC 1.B.10) family |
Database References | KEGG: ecj:JW0401 STRING: 316385.ECDH10B_0367 |
Gene Functions References
- crystal structures of Escherichia coli Tsx in the absence and presence of nucleosides PMID: 15272310