Recombinant E.Coli Mlta-Interacting Protein (MIPA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00555P
Greater than 85% as determined by SDS-PAGE.
Recombinant E.Coli Mlta-Interacting Protein (MIPA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00555P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Mlta-Interacting Protein (MIPA) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P0A908 |
| Target Symbol | MIPA |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | EGKFSLGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFWFRGLGGGYYLWNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDDRKSTMMAGLSYAHFTQYGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKESARSGLRGYNPNDSWSPYLELSASYNFLGDWSVYGTARYTRLSDEVTDSPMVDKSWTGLISTGITYKF |
| Expression Range | 23-248aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 33.1 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May serve as a scaffold protein required for the formation of a complex with MrcB/PonB and MltA, this complex could play a role in enlargement and septation of the murein sacculus. |
| Subcellular Location | Cell outer membrane. |
| Protein Families | MipA/OmpV family |
| Database References | KEGG: ecj:JW1771 STRING: 316385.ECDH10B_1920 |
Gene Functions References
- findings suggested that MipA was a novel outer membrane protein related to antibiotic resistance PMID: 25940639
- The effect of the dimerization of PBP1B on its activities was studied with a newly developed in vitro murein synthesis assay with radioactively labeled lipid II precursor as substrate. PMID: 16154998
