Recombinant E.Coli Methyl-Accepting Chemotaxis Protein Ii (TAR) Protein (His-SUMO)

Name: Recombinant E.Coli Methyl-Accepting Chemotaxis Protein Ii (TAR) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10101P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant E.Coli Methyl-Accepting Chemotaxis Protein Ii (TAR) Protein (His-SUMO) is produced by our E.coli expression system. This is a cytoplasmic protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P07017
Target Symbol	TAR
Synonyms	tar; cheM; b1886; JW1875Methyl-accepting chemotaxis protein II; MCP-II; Aspartate chemoreceptor protein
Species	Escherichia coli (strain K12)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	IRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAASPLTNKPQTPSRPASEQPPAQPRLRIAEQDPNWETF
Expression Range	212-553aa
Protein Length	Cytoplasmic Domain
Mol. Weight	52.0kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for the attractant L-aspartate and related amino and dicarboxylic acids. Tar also mediates taxis to the attractant maltose via an interaction with the periplasmic maltose binding protein. Tar mediates taxis away from the repellents cobalt and nickel.; Chemotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and removed by the methylesterase CheB.
Subcellular Location	Cell inner membrane; Multi-pass membrane protein. Note=Found predominantly at cell poles.
Database References	KEGG: ecj:JW1875 STRING: 316385.ECDH10B_2027

Gene Functions References

Thus, the proportion of polypeptide chain that is locally and presumably transiently disordered is a structural feature of cytoplasmic domain dynamics that varies with functional region and modification-induced signaling state. PMID: 27318193
There is a differential repositioning of the second transmembrane helices from E. coli Tar and EnvZ upon moving the flanking aromatic residues. PMID: 25445668
the Tar(FO) modules demonstrate that trimerized signaling tips self-associate, bind CheA and CheW, and facilitate conversion of CheA to an active conformation. PMID: 25967982
Residues at the cytoplasmic end of transmembrane helix 2 determine the signal output of the Tar chemoreceptor. PMID: 23495653
Such inversion is enabled by opposing pH sensing by the two major chemoreceptors, Tar and Tsr, such that the relative strength of the response is modulated by adaptive receptor methylation. PMID: 23078189
Here we report the overexpression system for aCB2 in Escherichia coli C43(DE3) facilitated by two fusion partners: Mistic and TarCF, a C-terminal fragment of the bacterial chemosensory transducer Tar at the C-terminal of the CB2 open reading frame region. PMID: 22406258
characterization of structural features of carboxyl-terminal 40 residues of Tar; identifed carboxyl-terminal linker between receptor body and the pentapeptide is an unstructured, disordered segment that can serve as a flexible arm and enzyme tether PMID: 21858888
Ligand specificity is determined by differentially arranged common ligand-binding residues in bacterial amino acid chemoreceptors Tsr and Tar PMID: 21979954
Tar molecules with the cytoplasmic methylation and kinase control domains of Tsr still sensed phenol as an attractant. PMID: 21965561
The cytoplasmic domains of Tar and Tsr receptors are close to each other near the trimer contact region at the cytoplasmic tip. PMID: 21174433
These results with Tar-EnvZ hybrid receptor mutants suggest that intersubunit interactions in the HAMP linker normally mediate signal transduction through both subunits in a sensor dimer. PMID: 15316026
mutations in the protein motifs of Tar significantly reduced the ability of the transmembrane domains to dimerize PMID: 15330757
The tryptophan residues flanking the second transmembrane helix of Tar, especially Trp-209, are crucial in setting the baseline activity and ligand sensitivity of this chemoreceptor. PMID: 15667220
assisted adaptational modification (methylation, demthylation and deamidation) in vitro of Trg chemorecptor PMID: 15916610
polar localization of Tar fused to green fluorescent protein is influenced by its own amidation (methylation) state and the expression of another chemoreceptor (Tsr) PMID: 16267289
Data show that Tar can be readily mutated to respond to new chemical signals, but that the overall change in specificity depends on the target compound. PMID: 16359703
The pentapeptide linker in Tar is important for chemotaxis because of its role in adaptational modification. PMID: 16573695
The fundamental mechanism of transmembrane signaling is conserved between homodimeric sensor kinases (with NarX) and chemoreceptors. PMID: 16707686
Data suggest that Tar()-Tsr* suppression most likely occurs through compensatory changes in the conformation or dynamics of a mixed receptor signaling complex, presumably based on trimer-of-dimer interactions. PMID: 16751275
The organization of these receptor/signaling complexes is determined by conserved interactions between the constituent chemotaxis proteins and may represent the active form in vivo. PMID: 16973743
A mutational analysis of Tar residues 505-548 reveals that the more of this region is deleted, the less sensitive Tar is to inhibition by aspartate. PMID: 19053273

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.