Recombinant E.Coli Methionine Aminopeptidase (MAP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03843P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Methionine Aminopeptidase (MAP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03843P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Methionine Aminopeptidase (MAP) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0AE18 |
| Target Symbol | MAP |
| Synonyms | map; b0168; JW0163Methionine aminopeptidase; MAP; MetAP; EC 3.4.11.18; Peptidase M |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE |
| Expression Range | 2-264aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 45.2kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed. |
| Protein Families | Peptidase M24A family, Methionine aminopeptidase type 1 subfamily |
| Database References | KEGG: ecj:JW0163 STRING: 316385.ECDH10B_0147 |
Gene Functions References
- These data suggest that map expression contributes to the maintenance of enteropathogenic Escherichia coli colonization. PMID: 25312947
- Methionine aminopeptidase associates with ribosomes via a charged loop crucial for nascent-chain processing & cell viability. It competes with peptide deformylase for binding sites at the ribosomal tunnel exit PMID: 23770820
- Data show that Europium ion (Eu(3+)) binds to methionine aminopeptidase and binding results in the activation of the enzyme. PMID: 22112844
- obtained a crystal structure for a complex of Escherichia coli methionine aminopeptidase with norleucine phosphonate, a transition-state analog, and only a single Mn(II) ion bound at the active site PMID: 16769889
