Recombinant E.Coli Lipopolysaccharide Assembly Protein B (LAPB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00648P

Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli Lipopolysaccharide Assembly Protein B (LAPB) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00648P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant E.Coli Lipopolysaccharide Assembly Protein B (LAPB) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P0AB58 |
Target Symbol | LAPB |
Species | Escherichia coli 1303 |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | WYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGFTAYTLYWHCPSCRAWSTIKPIRGLDGL |
Expression Range | 17-389aa |
Protein Length | Partial |
Mol. Weight | 46.9 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Modulates cellular lipopolysaccharide (LPS) levels by regulating LpxC, which is involved in lipid A biosynthesis. May act by modulating the proteolytic activity of FtsH towards LpxC. May also coordinate assembly of proteins involved in LPS synthesis at the plasma membrane. |
Subcellular Location | Cell inner membrane; Single-pass membrane protein; Cytoplasmic side. |
Protein Families | LapB family |
Database References | KEGG: ecj:JW1272 STRING: 316385.ECDH10B_1397 |
Gene Functions References
- Rubredoxin binds nine TPR motifs to form LapB, an essential regulator of lipopolysaccharide synthesis. PMID: 26190574
- Study demonstrates an essential role for YciM in regulation of lipopolysaccharide biosynthesis in E. coli. PMID: 24266962
- Results indicate that YciM is required for envelope integrity. PMID: 24187084