Recombinant E.Coli Iron-Sulfur Cluster Repair Protein Ytfe (YTFE) Protein (GST), Active
Beta LifeScience
SKU/CAT #: BLC-05642P
Recombinant E.Coli Iron-Sulfur Cluster Repair Protein Ytfe (YTFE) Protein (GST), Active
Beta LifeScience
SKU/CAT #: BLC-05642P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli Iron-Sulfur Cluster Repair Protein Ytfe (YTFE) Protein (GST), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 μg/ml can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 μg/ml. |
| Uniprotkb | P69506 |
| Target Symbol | YTFE |
| Synonyms | ytfE; b4209; JW4167; Iron-sulfur cluster repair protein YtfE; Regulator of cell morphogenesis and NO signaling; RCMNS |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE |
| Expression Range | 1-220aa |
| Protein Length | Full Length |
| Mol. Weight | 51.9kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. |
| Subcellular Location | Cytoplasm. |
| Protein Families | RIC family, YtfE subfamily |
| Database References | KEGG: ecj:JW4167 STRING: 316385.ECDH10B_4404 |
Gene Functions References
- Escherichia coli RIC is able to donate iron to iron-sulfur clusters. PMID: 24740378
- The authors confirm that YtfE is required to repair damage to iron-sulfur centres and for hydrogen peroxide resistance. PMID: 20138195
