Recombinant E.Coli 8-Oxo-Dgtp Diphosphatase (MUTT) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03846P

Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli 8-Oxo-Dgtp Diphosphatase (MUTT) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03846P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant E.Coli 8-Oxo-Dgtp Diphosphatase (MUTT) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P08337 |
Target Symbol | MUTT |
Synonyms | mutT; b0099; JW0097; 8-oxo-dGTP diphosphatase; 8-oxo-dGTPase; EC 3.6.1.55; 7,8-dihydro-8-oxoguanine-triphosphatase; Mutator protein MutT; dGTP pyrophosphohydrolase |
Species | Escherichia coli (strain K12) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL |
Expression Range | 1-129aa |
Protein Length | Full Length |
Mol. Weight | 30.9kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Specifically hydrolyzes both 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to the related monophosphates, thereby cleaning up the nucleotide pools and preventing misincorporation of 8-oxoGua into DNA and RNA. It prevents replicational errors by removing an oxidatively damaged form of guanine (8-oxo-dGTP) from DNA and the nucleotide pool. 8-oxo-dGTP can be inserted opposite dA and dC residues of template DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT may also ensure transcriptional fidelity, removing 8-oxo-GTP from the ribonucleotide triphosphate pool. However, due to the lower efficiency of RNA polymerase 8-oxo-GTP incorporation, MutT is probably not a major contributor to transcriptional fidelity. It also hydrolyzes 8-oxo-dGDP and 8-oxo-GDP to their monophosphate form. In vitro, can also use dGTP, dGDP and other various nucleoside di- and triphosphates, with much lower efficiency. Works cooperatively with MutM and MutY to prevent accumulation in the DNA of oxidized guanine residues. |
Protein Families | Nudix hydrolase family |
Database References | KEGG: ecj:JW0097 STRING: 316385.ECDH10B_0081 |
Gene Functions References
- The study investigated the role of MutT on transcription fidelity and find no increase in epigenetic switch frequency in the absence of MutT function. PMID: 25294823
- MutT mutation increased the point-mutation rate 150-fold. PMID: 23248287
- The MutT functions are not needed under anaerobic condition, yet the level of the MutT protein in cell is kept constant, probably for preparing for sudden changes of oxygen pressure. PMID: 21147134
- MutT hydrolyzes four types of 8-oxoGua (8-oxo-7,8-dihydroguanine)-containing nucleoside diphosphates and triphosphates to the related monophosphates, thereby preventing misincorporation of 8-oxoGua into DNA and RNA. PMID: 15850400
- transient state kinetic analysis of the reaction pathway of mutT; findings confirm an iso kinetic mechanism and explain the preferred hydrolysis of 8-oxo-dGTP PMID: 16285737
- These results indicate that mutT plays important roles in mutagenesis induced by 2-OH-dATP and 8-OH-dGTP in vivo. PMID: 17150583
- The mutT defect does not elevate chromosomal fragmentation in Escherichia coli because of the surprisingly low levels of MutM/MutY-recognized DNA modifications. PMID: 17616589