Recombinant E.Coli 30S Ribosomal Protein S15 (RPSO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03585P
Greater than 90% as determined by SDS-PAGE.
Recombinant E.Coli 30S Ribosomal Protein S15 (RPSO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03585P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant E.Coli 30S Ribosomal Protein S15 (RPSO) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0ADZ4 |
| Target Symbol | RPSO |
| Synonyms | rpsO; secC; b3165; JW3134; 30S ribosomal protein S15; Small ribosomal subunit protein uS15 |
| Species | Escherichia coli (strain K12) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR |
| Expression Range | 2-89aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 14.1kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. Binds to its own mRNA, stabilizing it 5-UTR and preventing its translation.; In the E.coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures there are minor differences between side-chain conformations. |
| Protein Families | Universal ribosomal protein uS15 family |
| Database References | KEGG: ecj:JW3134 STRING: 316385.ECDH10B_3339 |
Gene Functions References
- In the stalled state, the folded mRNA prevents the start codon from reaching the peptidyl-tRNA (P) site inside the ribosome. Upon S15/repressor release, the mRNA unfolds and moves into the mRNA channel allowing translation initiation. PMID: 17889647
