Recombinant E. coli Nitroreductase Protein

Beta LifeScience SKU/CAT #: BLA-3723P
Recombinant E. coli  Nitroreductase Protein

Recombinant E. coli Nitroreductase Protein

Beta LifeScience SKU/CAT #: BLA-3723P
Catalog No.: BLA-3723P

Product Overview

Host Species Escherichia coli
Accession P38489
Synonym Dihydropteridine reductase dprA FMN dependent nitroreductase nfnB nfsI ntr Oxygen insensitive NAD(P)H nitroreductase
Description Recombinant E. coli Nitroreductase Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMDIISVALKRHSTKAFDASKKLTPEQAEQI KTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASH VVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRK DLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
Molecular Weight 26 kDa including tags
Purity >95% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed