Recombinant Drosophila Melanogaster Sterile Alpha And Tir Motif-Containing Protein 1 (ECT4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01015P
Greater than 85% as determined by SDS-PAGE.
Recombinant Drosophila Melanogaster Sterile Alpha And Tir Motif-Containing Protein 1 (ECT4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01015P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Drosophila Melanogaster Sterile Alpha And Tir Motif-Containing Protein 1 (ECT4) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q6IDD9 |
| Target Symbol | ECT4 |
| Synonyms | (NADase sarm1)(Sterile alpha and TIR motif-containing protein 1)(Tir-1 homolog) |
| Species | Drosophila melanogaster (Fruit fly) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | KSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSSAQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSDVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHNDDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIASKFAAQALRLIGET |
| Expression Range | 370-678aa(A386L,H392R,T433V,T434A,L595S,A596D,H599Q) |
| Protein Length | Partial |
| Mol. Weight | 37.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | NAD(+) hydrolase, which plays a key role in axonal degeneration following injury by regulating NAD(+) metabolism. Acts as a negative regulator of MYD88- and TRIF-dependent toll-like receptor signaling pathway by promoting Wallerian degeneration, an injury-induced form of programmed subcellular death which involves degeneration of an axon distal to the injury site. Wallerian degeneration is triggered by NAD(+) depletion: in response to injury, it is activated and catalyzes cleavage of NAD(+) into ADP-D-ribose (ADPR), cyclic ADPR (cADPR) and nicotinamide; NAD(+) cleavage promoting axon destruction. Involved in the down-regulation of the tracheal immune response to Gram-negative bacteria. This is likely by mediating Tollo signaling in the tracheal epithelium. |
| Subcellular Location | Cytoplasm. Cell projection, axon. |
| Database References | KEGG: dme:Dmel_CG43119 STRING: 7227.FBpp0293535 UniGene: PMID: 27960110 |
