Recombinant Drosophila Melanogaster Probable Insulin-Like Peptide 7 (ILP7) Protein (His&Myc)

Name: Recombinant Drosophila Melanogaster Probable Insulin-Like Peptide 7 (ILP7) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-10940P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Drosophila Melanogaster Probable Insulin-Like Peptide 7 (ILP7) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9W4Q9
Target Symbol	ILP7
Synonyms	Ilp7; CG13317; Probable insulin-like peptide 7; dILP7; Insulin-related peptide 7) [Cleaved into: Probable insulin-like peptide 7 A chain; Probable insulin-like peptide 7 B chain]
Species	Drosophila melanogaster (Fruit fly)
Expression System	Baculovirus
Tag	N-10His&C-Myc
Target Protein Sequence	LQHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY
Expression Range	32-159aa
Protein Length	Full Length of Mature Protein
Mol. Weight	19.3 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Secreted.
Protein Families	Insulin family
Database References	KEGG: dme:Dmel_CG13317 STRING: 7227.FBpp0070552 UniGene: Dm.26448
Tissue Specificity	Broadly expressed at a low level throughout the embryo, except the yolk. Expressed at a moderate level in the embryonic midgut. Larval expression is restricted to ten cells of the ventral nerve cord - in four pairs of centrally located cells in the most p

Gene Functions References

Drosophila female-specific Ilp7 motoneurons are generated by Fruitless-dependent cell death in males and by a double-assurance survival role for Transformer in females. PMID: 29229771
PERK/ATF4 activated the JNK pathway through Rac1 and Slpr activation in apoptotic cells, leading to the expression of Dilp8. PMID: 25299777
A post-embryonic population of Insulin-like peptide 7 (Ilp7)-expressing neurons in the posterior ventral nerve cord that innervate the reproductive tracts and exhibit a female bias in their function, are identified. PMID: 23981656
Surviving posterior dMP2 neurons no longer function in axonal scaffolding but differentiate into neuroendocrine cells that express insulin-like peptide 7 (Ilp7) and innervate the hindgut. PMID: 18336071

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.