Recombinant Drosophila Melanogaster Peptidoglycan-Recognition Protein Sc2 (PGRP-SC2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01059P
Greater than 90% as determined by SDS-PAGE.
Recombinant Drosophila Melanogaster Peptidoglycan-Recognition Protein Sc2 (PGRP-SC2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01059P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Drosophila Melanogaster Peptidoglycan-Recognition Protein Sc2 (PGRP-SC2) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9V4X2 |
| Target Symbol | PGRP-SC2 |
| Species | Drosophila melanogaster (Fruit fly) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | VTIISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWKA |
| Expression Range | 21-184aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 25.2 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | N-acetylmuramyl-L-alanine amidase involved in innate immunity by degrading bacterial peptidoglycans (PGN). Probably plays a scavenger role by digesting biologically active PGN into biologically inactive fragments. Has no direct bacteriolytic activity. |
| Subcellular Location | Secreted. |
| Protein Families | N-acetylmuramoyl-L-alanine amidase 2 family |
| Database References | KEGG: dme:Dmel_CG14745 STRING: 7227.FBpp0087788 |
| Tissue Specificity | Constitutively expressed at high level in gut, in addition to the induced expression in fat body. |
Gene Functions References
- The aging intestine of Drosophila, chronic activation of the transcription factor Foxo reduces expression of peptidoglycan recognition protein SC2 (PGRP-SC2), a negative regulator of IMD/Relish innate immune signaling, and homolog of the anti-inflammatory molecules PGLYRP1-4. PMID: 24439372
- Report that PGRP-SC1/2-depleted flies present over-activation of the immune deficiency signaling pathway after bacterial challenge suggesting that these proteins act in the larval gut to prevent activation of this pathway following bacterial ingestion. PMID: 16518472
