Recombinant Drosophila Melanogaster Neuroglian (NRG) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07107P
Greater than 90% as determined by SDS-PAGE.
Recombinant Drosophila Melanogaster Neuroglian (NRG) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07107P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Drosophila Melanogaster Neuroglian (NRG) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P20241 |
| Target Symbol | NRG |
| Species | Drosophila melanogaster (Fruit fly) |
| Expression System | Baculovirus |
| Tag | C-6His |
| Target Protein Sequence | IVQDVPNAPKLTGITCQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYSGEDR |
| Expression Range | 610-814aa |
| Protein Length | Partial |
| Mol. Weight | 28.6 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The long isoform may play a role in neural and glial cell adhesion in the developing embryo. The short isoform may be a more general cell adhesion molecule involved in other tissues and imaginal disk morphogenesis. Vital for embryonic development. Essential for septate junctions. Septate junctions, which are the equivalent of vertebrates tight junctions, are characterized by regular arrays of transverse structures that span the intermembrane space and form a physical barrier to diffusion. Required for the blood-brain barrier formation. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cell junction, tight junction. |
| Database References | KEGG: dme:Dmel_CG1634 STRING: 7227.FBpp0297081 UniGene: PMID: 25825519 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
