Recombinant Dog Interleukin-8 (CXCL8) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10820P
Greater than 90% as determined by SDS-PAGE.
Recombinant Dog Interleukin-8 (CXCL8) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10820P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Dog Interleukin-8 (CXCL8) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P41324 |
Target Symbol | CXCL8 |
Synonyms | CXCL8; IL8; Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8 |
Species | Canis lupus familiaris (Dog) (Canis familiaris) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
Expression Range | 23-101aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 11.1kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. |
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database References |
Gene Functions References
- Analysis of ROC suggests the use of serum levels of MCP-1 and IL-7 as predictors of the occurrence of complications with an AUC of 0.906 and 0.896 respectively and linear combinations of MCP-1, KC-Like, IL-7 and GM-CSF with values up to AUC = 0.983 PMID: 29304171
- These observations indicate that the individual activation of ERK2 and JNK1 pathways contributes to TNF-alpha-induced IL-8 expression in synovial fibroblasts. PMID: 28806729
- data suggest that CCL2 acts as a PMNs chemotactic factor as well as CXCL8, and both CCL2 and CXCL8 facilitate the infiltration of PMNs into the joints of idiopathic polyarthritis PMID: 27863550
- The study findings suggest that both CCL2 and CXCL8 are involved in the pathogenesis of canine idiopathic pulmonary fibrosis. PMID: 26231926
- High CXCL8 blood concentrations might be related to the breed predisposition of the West Highland white terrier for canine idiopathic pulmonary fibrosis. PMID: 26267090
- IL-8-positive macrophages were significantly increased in large polyps compared to controls PMID: 24148828
- hemangiosarcoma derived IL-8 may play a role in tumor development by modulating the tumor microenvironment PMID: 24582862
- Data indicate that the Leishmania braziliensis antigens plus saponin (LBSap) vaccine induced high levels of IL-12, IL-10, CCL4, CCL5 and CXCL8 expression within 48 hours. PMID: 23911411
- serum and tumor levels of IL-8 and IL-10 in dogs bearing benign and malignant mammary tumors, including dogs with inflammatory mammary cancer, for a better understanding of this disease PMID: 23351639
- Sixty-one percent (28/46) of the samples from canine stifle osteoarthritis had IL-8 mRNA expression in contrast to 4% (1/24) in the control stifle joints PMID: 16102844
- Adipose tissue-derived mesenchymal stem cells expressed the mRNA of transforming growth factor beta (TGF-beta), IL-6, IL-8, CCL2, CCL5, VEGF,HGF, tissue inhibitor metalloproteinase-1/2, and cyclooxygenase-2 but not that of IL-10. PMID: 18717642