Recombinant Dog Interleukin-8 (CXCL8) Protein (His)

Name: Recombinant Dog Interleukin-8 (CXCL8) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08582P
Price: 764.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Chemokines and receptors, Cytokines, Cytokines and growth factors, Interleukins and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Dog Interleukin-8 (CXCL8) Protein (His) is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P41324
Target Symbol	CXCL8
Synonyms	CXCL8; IL8; Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8
Species	Canis lupus familiaris (Dog) (Canis familiaris)
Expression System	Mammalian cell
Tag	N-6His
Target Protein Sequence	AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Expression Range	23-101aa
Protein Length	Full Length of Mature Protein
Mol. Weight	13.1kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	KEGG: cfa:403850 STRING: 9615.ENSCAFP00000004516 UniGene: Cfa.3510

Gene Functions References

Analysis of ROC suggests the use of serum levels of MCP-1 and IL-7 as predictors of the occurrence of complications with an AUC of 0.906 and 0.896 respectively and linear combinations of MCP-1, KC-Like, IL-7 and GM-CSF with values up to AUC = 0.983 PMID: 29304171
These observations indicate that the individual activation of ERK2 and JNK1 pathways contributes to TNF-alpha-induced IL-8 expression in synovial fibroblasts. PMID: 28806729
data suggest that CCL2 acts as a PMNs chemotactic factor as well as CXCL8, and both CCL2 and CXCL8 facilitate the infiltration of PMNs into the joints of idiopathic polyarthritis PMID: 27863550
The study findings suggest that both CCL2 and CXCL8 are involved in the pathogenesis of canine idiopathic pulmonary fibrosis. PMID: 26231926
High CXCL8 blood concentrations might be related to the breed predisposition of the West Highland white terrier for canine idiopathic pulmonary fibrosis. PMID: 26267090
IL-8-positive macrophages were significantly increased in large polyps compared to controls PMID: 24148828
hemangiosarcoma derived IL-8 may play a role in tumor development by modulating the tumor microenvironment PMID: 24582862
Data indicate that the Leishmania braziliensis antigens plus saponin (LBSap) vaccine induced high levels of IL-12, IL-10, CCL4, CCL5 and CXCL8 expression within 48 hours. PMID: 23911411
serum and tumor levels of IL-8 and IL-10 in dogs bearing benign and malignant mammary tumors, including dogs with inflammatory mammary cancer, for a better understanding of this disease PMID: 23351639
Sixty-one percent (28/46) of the samples from canine stifle osteoarthritis had IL-8 mRNA expression in contrast to 4% (1/24) in the control stifle joints PMID: 16102844
Adipose tissue-derived mesenchymal stem cells expressed the mRNA of transforming growth factor beta (TGF-beta), IL-6, IL-8, CCL2, CCL5, VEGF,HGF, tissue inhibitor metalloproteinase-1/2, and cyclooxygenase-2 but not that of IL-10. PMID: 18717642

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.