Recombinant Dog Interleukin-33 (IL33) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00985P

Greater than 85% as determined by SDS-PAGE.
Recombinant Dog Interleukin-33 (IL33) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00985P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Dog Interleukin-33 (IL33) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O97863 |
Target Symbol | IL33 |
Synonyms | (IL-33)(Protein DVS27) |
Species | Canis lupus familiaris (Dog) (Canis familiaris) |
Expression System | Baculovirus |
Tag | N-10His |
Target Protein Sequence | CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS |
Expression Range | 102-263aa |
Protein Length | Partial |
Mol. Weight | 21.0 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation. |
Subcellular Location | Nucleus. Chromosome. Cytoplasm. Cytoplasmic vesicle, secretory vesicle. Secreted. |
Protein Families | IL-1 family |
Database References | KEGG: cfa:403810 UniGene: Cfa.3672 |
Tissue Specificity | Expressed in cultured umbilical artery smooth muscle cells after stimulation with IL1A and IL1B, and to a lesser extent with IFNG. Expressed in vasospastic cerebral arteries after subarachnoid hemorrhage. |