Recombinant Dog C-C Motif Chemokine 17 (CCL17) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-01538P
Greater than 85% as determined by SDS-PAGE.
Recombinant Dog C-C Motif Chemokine 17 (CCL17) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-01538P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Dog C-C Motif Chemokine 17 (CCL17) Protein (His-KSI) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q95N01 |
Target Symbol | CCL17 |
Synonyms | CC chemokine TARC;Small-inducible cytokine A17;Thymus and activation-regulated chemokine |
Species | Canis familiaris (Dog) (Canis lupus familiaris) |
Expression System | E.coli |
Tag | N-6His-KSI |
Target Protein Sequence | ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES |
Expression Range | 24-99aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 23.9 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References | |
Tissue Specificity | Expressed in thymus, spleen, lymph node, lung and heart. |
Gene Functions References
- The present results suggest that TNF-alpha-induced CCL17 mRNA transcription in canine keratinocytes is positively regulated by p38 but negatively controlled by ERK. PMID: 20837364
- This study suggests that interferon-gamma may suppress granulocyte-macrophage colony stimulating factor production from canine keratinocytes, although further studies are required to confirm this. PMID: 20860556
- Inflammatory cytokines are important inducing factors for the production of CCL17 in the lesional skin of dogs with atopic dermatitis. atopic dermatitis. PMID: 20022349