Recombinant Dog B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00705P

Greater than 90% as determined by SDS-PAGE.
Recombinant Dog B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00705P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Dog B-Lymphocyte Antigen Cd20 (MS4A1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q3C2E2 |
Target Symbol | MS4A1 |
Synonyms | (Membrane-spanning 4-domains subfamily A member 1)(CD antigen CD20) |
Species | Canis lupus familiaris (Dog) (Canis familiaris) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | GIVENEWKKLCSKPKSDVVVLLAAEEKKEQPIETTEEMVELTEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP |
Expression Range | 210-297aa |
Protein Length | Partial |
Mol. Weight | 17.4 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor. |
Protein Families | MS4A family |
Database References | KEGG: cfa:485430 STRING: 9615.ENSCAFP00000035044 UniGene: PMID: 27856424 |