Recombinant Cynomolgus Monkey Interleukin-11 (IL11) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05193P

Greater than 85% as determined by SDS-PAGE.
Recombinant Cynomolgus Monkey Interleukin-11 (IL11) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05193P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Cynomolgus Monkey Interleukin-11 (IL11) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P20808 |
Target Symbol | IL11 |
Synonyms | IL11; Interleukin-11; IL-11 |
Species | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Expression Range | 22-199aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 25.4 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'. |
Subcellular Location | Secreted. |
Protein Families | IL-6 superfamily |
Database References | KEGG: mcf:102118349 UniGene: Mfa.5402 |