Recombinant Cynomolgus monkey IL4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0853P
Recombinant Cynomolgus monkey IL4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0853P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | P79339 |
Synonym | B cell growth factor 1 B cell IgG differentiation factor B Cell Stimulatory Factor 1 B-cell stimulatory factor 1 BCGF 1 BCGF1 Binetrakin BSF-1 BSF1 IGG1 induction factor IL 4 IL-4 IL4 IL4_HUMAN Il4e12 Interleukin 4 Interleukin 4 variant 2 Interleukin 4, isoform 1 Interleukin-4 Lymphocyte stimulatory factor 1 MGC79402 Pitrakinra |
Description | Recombinant Cynomolgus monkey IL4 Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAAT VLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCP VKEANQSTLENFLERLKTIMREKYSKCSS |
Molecular Weight | 17 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. |
Subcellular Location | Secreted. |
Protein Families | IL-4/IL-13 family |
Database References | UniGene: Mfa.6178 |