Recombinant Cow IFNW1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1799P
Recombinant Cow IFNW1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1799P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cow |
Accession | P07352 |
Synonym | IFNW1 IFNW1_HUMAN Interferon alpha II 1 Interferon alpha-II-1 Interferon omega 1 Interferon omega-1 |
Description | Recombinant Cow IFNW1 Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQE AQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACL GLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMR SLSSSTSLQERLRMMDGDLKSP |
Molecular Weight | 36 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Subcellular Location | Secreted. |
Protein Families | Alpha/beta interferon family |
Database References |