Recombinant Conus Marmoreus Mu-Conotoxin Mrvib Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-06738P
Greater than 85% as determined by SDS-PAGE.
Recombinant Conus Marmoreus Mu-Conotoxin Mrvib Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-06738P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Conus Marmoreus Mu-Conotoxin Mrvib Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q26443 |
| Target Symbol | Q26443 |
| Species | Conus marmoreus (Marble cone) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | ACSKKWEYCIVPILGFVYCCPGLICGPFVCV |
| Expression Range | 52-82aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 30.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | MuO-conotoxins are gating-modifier toxins that inhibit sodium current by trapping the domain II voltage sensor in the closed position to prevent opening of the sodium channel. This toxin has a preference for Nav1.4/SCN4A over Nav1.2/SCN2A sodium channels. It blocks Nav channels by interacting mainly with the C-terminal part of the pore loop of domain-3. It also blocks fast-inactivating calcium current. Blocks Nav1.8/SCN10A sodium channels and has potent and long-lasting local anesthetic effects. It can also block propagation of action potentials in A- and C-fibers in sciatic nerve as well as skeletal muscle in isolated preparations. |
| Subcellular Location | Secreted. |
| Protein Families | Conotoxin O1 superfamily |
| Tissue Specificity | Expressed by the venom duct. |
