Recombinant Chlamydia Trachomatis Small Cysteine-Rich Outer Membrane Protein Omca (OMCA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02737P
Greater than 90% as determined by SDS-PAGE.
Recombinant Chlamydia Trachomatis Small Cysteine-Rich Outer Membrane Protein Omca (OMCA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02737P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Chlamydia Trachomatis Small Cysteine-Rich Outer Membrane Protein Omca (OMCA) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P0CC05 |
| Target Symbol | OMCA |
| Synonyms | omcA; omp2A; omp3; CT_444; Small cysteine-rich outer membrane protein OmcA; Small-CRP; 9 kDa cysteine-rich lipoprotein; 9kDa-CRP |
| Species | Chlamydia trachomatis (strain D/UW-3/Cx) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ |
| Expression Range | 19-88aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 23.4kDa |
| Research Area | Microbiology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan. |
| Subcellular Location | Cell outer membrane; Lipid-anchor. Note=The protein moiety probably penetrates into the periplasm. |
| Database References | KEGG: ctr:CT_444 |
