Recombinant Chlamydia Pneumoniae Large Cysteine-Rich Periplasmic Protein Omcb (OMCB) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09027P
Greater than 90% as determined by SDS-PAGE.
Recombinant Chlamydia Pneumoniae Large Cysteine-Rich Periplasmic Protein Omcb (OMCB) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09027P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Chlamydia Pneumoniae Large Cysteine-Rich Periplasmic Protein Omcb (OMCB) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P23700 |
| Target Symbol | OMCB |
| Synonyms | omcB; omp2; CPn_0557; CP_0195; CpB0579; Large cysteine-rich periplasmic protein OmcB; Large-CRP; 60 kDa cysteine-rich OMP; 60 kDa CRP; 60 kDa outer membrane protein; Cysteine-rich outer membrane protein |
| Species | Chlamydia pneumoniae (Chlamydophila pneumoniae) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC |
| Expression Range | 41-196aa |
| Protein Length | Partial |
| Mol. Weight | 33.3kDa |
| Research Area | Microbiology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan. |
| Subcellular Location | Periplasm. |
| Database References | KEGG: cpa:CP_0195 STRING: 182082.CpB0579 |
