Recombinant Chinese Hamster Peroxiredoxin-1 (PRDX1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05211P
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.

Recombinant Chinese Hamster Peroxiredoxin-1 (PRDX1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05211P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Chinese Hamster Peroxiredoxin-1 (PRDX1) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9JKY1
Target Symbol PRDX1
Synonyms PRDX1; TDPX2Peroxiredoxin-1; EC 1.11.1.15; Thioredoxin peroxidase 2; TPX-2
Species Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Expression System Yeast
Tag N-6His
Target Protein Sequence SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Expression Range 2-199aa
Protein Length Full Length of Mature Protein
Mol. Weight 24.2 kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation.
Subcellular Location Cytoplasm.
Protein Families Peroxiredoxin family, AhpC/Prx1 subfamily
Database References

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from All Products
Tn5 Transposase
  • Expression system: E.coli;
CAT#: TN5-BL01
Sale
SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
  • Molecule: SHFL;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His+sumo;
  • Sequence: 1-291;
CAT#: BLT-08873P

Save $50
Sale
SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
  • Molecule: SFTPA1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His;
  • Sequence: 21-248;
CAT#: BLT-08790P

Save $50
Sale
SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
  • Molecule: SFTPA2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His;
  • Sequence: 21-248;
CAT#: BLT-08789P

Save $50
Sale
SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
  • Molecule: NDUFV1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His+SUMO;
  • Sequence: 21-464aa;
CAT#: BLT-08321P

Save $50
Sale
SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
Human NEU2 (Sialidase-2) - Recombinant Protein
  • Molecule: NEU2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His;
  • Sequence: 1-380aa;
CAT#: BLT-08142P

Save $50
Recently viewed