Recombinant Chicken RANTES Protein
Beta LifeScience
SKU/CAT #: BLA-2137P
Recombinant Chicken RANTES Protein
Beta LifeScience
SKU/CAT #: BLA-2137P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Chicken |
Accession | 417465 |
Synonym | Beta chemokine RANTES Beta chemokine RANTES precursor C C motif chemokine 5 CCL 5 CCL5 CCL5_HUMAN Chemokine (C C motif) ligand 5 Chemokine CC Motif Ligand 5 D17S136E EoCP Eosinophil chemotactic cytokine MGC17164 RANTES(4-68) Regulated upon activation normally T expressed and presumably secreted SCYA 5 SCYA5 SIS delta SIS-delta SISd Small inducible cytokine A5 Small inducible cytokine A5 (RANTES) Small inducible cytokine subfamily A (Cys Cys) member 5 Small-inducible cytokine A5 T cell specific protein p288 T cell specific protein RANTES T cell specific RANTES protein T cell-specific protein P228 T-cell-specific protein RANTES TCP 228 TCP228 |
Description | Recombinant Chicken RANTES Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | SPFGADTTVCCFNYSVRKLPQNHVKDYFYTSSKCPQAAVVFITRKGRQVC ANPDARWVKEYINFLELQ |
Molecular Weight | 8 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |