Recombinant Cat Major Allergen I Polypeptide Chain 1 (CH1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00583P
Greater than 85% as determined by SDS-PAGE.
Recombinant Cat Major Allergen I Polypeptide Chain 1 (CH1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00583P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Cat Major Allergen I Polypeptide Chain 1 (CH1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P30438 |
| Target Symbol | CH1 |
| Synonyms | (AG4)(Allergen Cat-1)(Allergen Fel d I-A)(Allergen FdI)(Allergen Fel dI)(allergen Fel d 1-A) |
| Species | Felis catus (Cat) (Felis silvestris catus) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC |
| Expression Range | 23-92aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 15.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Subcellular Location | Secreted. |
| Protein Families | Secretoglobin family |
| Tissue Specificity | Saliva and sebaceous glands. |
Gene Functions References
- Cat Fel d 1 is an ABP-like molecule in which monomeric chains 1 and 2 are the equivalent of the ABPA and ABPBG monomers, respectively. These findings suggest that the biological and molecular function of Fel d 1 is similar to that of ABP in chemical communication, possibly via pheromone and/or steroid binding. PMID: 29771985
- Conformational effects brought upon by glycosylation were identified, potentially involved in cavity volume regulation. Only the central Ca2+ ion remains coordinated to Fel d 1 in biological solutions, impairing its role in modulating phospholipase A2. PMID: 26134118
- Truncated dimers of Fel d 1 were identified, probably resulting from proteolytic degradation of both chains and present in all cats. Core fragments are largely distributed among anatomical sites of production and especially well represented in anal sac. PMID: 20145408
- Crystals of Fel d 1 (1+2) were obtained using the hanging-drop vapour-diffusion method. PMID: 16511003
