Recombinant Cat Interferon gamma/IFNG Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0814P
Recombinant Cat Interferon gamma/IFNG Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0814P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cat |
Accession | P46402 |
Synonym | IF 1 IFG IFI IFN gamma IFN immune IFN, immune IFN-gamma IFNG IFNG_HUMAN Immune interferon Interferon gamma Type II Interferon |
Description | Recombinant Cat Interferon gamma/IFNG Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSQAMFFKEIEELKGYFNASNPDVADGGS LFVDILKNWKEESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKED MLDKLLNTSSSKRDDFLKLIQIPVNDLQVQRKAINELFKVMNDLSPRSNL RKRKRSQNLFRGRRASK |
Molecular Weight | 19 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |