Recombinant Candida Albicans Ph-Regulated Antigen Pra1 (PRA1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03288P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) PRA1.
Recombinant Candida Albicans Ph-Regulated Antigen Pra1 (PRA1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03288P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Candida Albicans Ph-Regulated Antigen Pra1 (PRA1) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P87020 |
| Target Symbol | PRA1 |
| Synonyms | PRA1; FBP1; CAALFM_C406980WA; CaO19.10623; CaO19.3111; pH-regulated antigen PRA1; 58 kDa fibrinogen-binding mannoprotein |
| Species | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNATQYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRKYFGNETASAEVVGHFDNVVGADKSSILFLCDDLDDKCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQLCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLVIEHYADTYEEVLELAQENSTYAVRNSNSLIYYALDVYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGSDSGASSTASSSHQHTDSNPSATTDANSHCHTHADGEVHC |
| Expression Range | 16-299aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 33.4 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cell surface protein involved in the host-parasite interaction during candidal infection. With MP65, represents a major component of the biofilm matrix. Sequesters zinc from host tissue and mediates leukocyte adhesion and migration. As a surface protein, binds the two human complement regulators CFH and CFHR1, as well as plasminogen PLG, mediates complement evasion and extra-cellular matrix interaction and/or degradation. As a released protein, enhances complement control in direct vicinity of the yeast and thus generates an additional protective layer which controls host complement attack, assisting the fungus in escaping host surveillance. Binds to host fluid-phase C3 and blocks cleavage of C3 to C3a and C3b, leading to inhibition of complement activation. Mediates also human complement control and complement evasion through binding to C4BPA, another human complement inhibitor, as well as through binding to host integrin alpha-M/beta-2. Decreases complement-mediated adhesion, as well as uptake of C.albicans by human macrophages. |
| Subcellular Location | Secreted. Note=Found primarily on the cell surface of filamentous forms and enriched at hyphal tips. |
| Protein Families | ZPS1 family |
| Database References | KEGG: cal:CAALFM_C406980WA |
Gene Functions References
- Pra1 is a hierarchical complement inhibitor that targets C3 by cleaving C3 at a unique site. This inhibited effector function of the activation fragments. Pra1 also bound to C3a and C3b generated by human convertases and blocked their effector functions, C3a binding to human C3a receptor, calcium signaling, IL-8 release, C3b deposition, opsonophagocytosis, and killing by neutrophils. PMID: 28860090
- surface-exposed Pra1 plays a role in the recognition of Candida albicans, especially hyphal cells, by human neutrophils PMID: 21820180
- recognition of pH-regulated antigen 1 protein (Pra1p) by integrin alpha(M)betaplays a pivotal role in determining fungal virulence and host response and protection against C. albicans infection PMID: 21245270
- Data show that the fungus secretes a potent complement inhibitor, pH-regulated Ag 1 (Pra1), which in the direct surrounding of the pathogen binds to fluid-phase C3 and blocks cleavage of C3 to C3a and C3b. PMID: 20644161
- Therefore, it appears that Pra1p can play at most a minor role in fibrinogen binding to C. albicans. PMID: 18625733
- The pH-regulated antigen 1 (Pra1) protein was identified as a novel Factor H and FHL-1 binding protein. PMID: 19850343
