Recombinant Candida Albicans Hyphal Wall Protein 1 (HWP1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11262P
Greater than 85% as determined by SDS-PAGE.
Recombinant Candida Albicans Hyphal Wall Protein 1 (HWP1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11262P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Candida Albicans Hyphal Wall Protein 1 (HWP1) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P46593 |
| Target Symbol | HWP1 |
| Synonyms | HWP1; ECE2; CAALFM_C403570WA; CaO19.1321; CaO19.8901; Hyphal wall protein 1; Cell elongation protein 2 |
| Species | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA |
| Expression Range | 27-203aa |
| Protein Length | Partial |
| Mol. Weight | 21.7 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Major hyphal cell wall protein which plays a role of adhesin and is required for mating, normal hyphal development, cell-to-cell adhesive functions necessary for biofilm integrity, attachment to host, and virulence. Promotes interactions with host and bacterial molecules, thus leading to effective colonization within polymicrobial communities. Plays a crucial role in gastrointestinal colonization, in mucosal symptomatic and asymptomatic infections, in vaginitis, as well as in lethal oroesophageal candidiasis, caused by the combined action of fungal virulence factors and host inflammatory responses when protective immunity is absent. |
| Subcellular Location | Secreted, cell wall. Membrane; Lipid-anchor, GPI-anchor. Note=Hyphal surface. Localizes to the a/a Portion of the conjugation bridge during mating. |
| Protein Families | HWP1 family |
| Database References | KEGG: cal:CAALFM_C403570WA |
Gene Functions References
- results elucidate HCR-dependent mechanisms for coupling HWP1-dependent gene expression to morphology uniformly in cell populations and prompt the hypothesis that mRNA isoforms may play a role in coupling gene expression to morphology in C. albicans PMID: 29438403
