Recombinant Candida Albicans Fructose-Bisphosphate Aldolase (FBA1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04919P
Greater than 85% as determined by SDS-PAGE.
Recombinant Candida Albicans Fructose-Bisphosphate Aldolase (FBA1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04919P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Candida Albicans Fructose-Bisphosphate Aldolase (FBA1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9URB4 |
| Target Symbol | FBA1 |
| Synonyms | FBA1; CAALFM_C401750CA; CaO19.12088; CaO19.4618Fructose-bisphosphate aldolase; FBP aldolase; FBPA; EC 4.1.2.13; 37 kDa major allergen; Fructose-1,6-bisphosphate aldolase; IgE-binding allergen |
| Species | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | APPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL |
| Expression Range | 2-359aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 46.5 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Catalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3-phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis. |
| Subcellular Location | Cytoplasm. |
| Protein Families | Class II fructose-bisphosphate aldolase family |
| Database References | KEGG: cal:CAALFM_C401750CA |
Gene Functions References
- To test if Fba1p is an antifungal target, the effects of depleting this enzyme in Candida albicans was investigated using a methionine/cysteine-conditional mutant (MET3-FBA1/fba1); and it was found that Fba1p is required for the growth of C. albicans. PMID: 16896220
