Recombinant Calloselasma Rhodostoma Snaclec Rhodocytin Subunit Beta Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-08703P
Greater than 90% as determined by SDS-PAGE.
Recombinant Calloselasma Rhodostoma Snaclec Rhodocytin Subunit Beta Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-08703P
Collections: Fc receptors, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Calloselasma Rhodostoma Snaclec Rhodocytin Subunit Beta Protein (His-B2M) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9I840 |
Target Symbol | Q9I840 |
Synonyms | ; Snaclec rhodocytin subunit beta; Aggretin beta chain; Rhodoaggretin subunit beta |
Species | Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma) |
Expression System | E.coli |
Tag | N-6His-B2M |
Target Protein Sequence | DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA |
Expression Range | 24-146aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 28.4kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. |
Subcellular Location | Secreted. |
Protein Families | Snaclec family |
Tissue Specificity | Expressed by the venom gland. |