Recombinant Bungarus Multicinctus Alpha-Bungarotoxin Isoform A31 (ALPHA-BGTX) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-08991P
Greater than 85% as determined by SDS-PAGE.
Recombinant Bungarus Multicinctus Alpha-Bungarotoxin Isoform A31 (ALPHA-BGTX) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-08991P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bungarus Multicinctus Alpha-Bungarotoxin Isoform A31 (ALPHA-BGTX) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P60615 |
| Target Symbol | P60615 |
| Synonyms | Alpha-bungarotoxin; Alpha-Bgtx; Alpha-Btx; Alpha-bungarotoxin isoform A31; Alpha-BTX A31; Alpha-Bgt(A31); BGTX A31; Long neurotoxin 1 |
| Species | Bungarus multicinctus (Many-banded krait) |
| Expression System | E.coli |
| Tag | N-10His-GST&C-Myc |
| Target Protein Sequence | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
| Expression Range | 22-95aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 38.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Binds with high affinity to muscular (tested on Torpedo marmorata, Kd=0.4 nM) and neuronal (tested on chimeric alpha-7/CHRNA7, Kd=0.95 nM) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission. It also shows an activity on GABA(A) receptors. It antagonises GABA-activated currents with high potency when tested on primary hippocampal neurons. It inhibits recombinantly expressed GABA(A) receptors composed of alpha-2-beta-2-gamma-2 (GABRA2-GABRB2-GABRG2) subunits with high potency (62.3% inhibition at 20 uM of toxin). It also shows a weaker inhibition on GABA(A) receptors composed of alpha-1-beta-2-gamma-2 (GABRA1-GABRB2-GABRG2) subunits, alpha-4-beta-2-gamma-2 (GABRA4-GABRB2-GABRG2) subunits, and alpha-5-beta-2-gamma-2 (GABRA5-GABRB2-GABRG2) subunits. A very weak inhibition is also observed on GABA(A) receptor composed of alpha-1-beta-3-gamma-2 (GABRA1-GABRB3-GABRG2). It has also been shown to bind and inhibit recombinant GABA(A) receptor beta-3/GABRB3 subunit (Kd=about 50 nM). In addition, it blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 uM). In vivo, when intraperitoneally injected into mice, induces flaccid paralysis of the limbs and respiratory distress, and causes death in a dose-dependent manner. |
| Subcellular Location | Secreted. |
| Protein Families | Snake three-finger toxin family, Long-chain subfamily, Type II alpha-neurotoxin sub-subfamily |
| Tissue Specificity | Expressed by the venom gland. |
