Recombinant Bovine Ubiquitin-Like Protein Isg15 (ISG15) Protein (His)

Beta LifeScience SKU/CAT #: BLC-04931P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Bovine Ubiquitin-Like Protein Isg15 (ISG15) Protein (His)

Beta LifeScience SKU/CAT #: BLC-04931P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Bovine Ubiquitin-Like Protein Isg15 (ISG15) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb O02741
Target Symbol ISG15
Synonyms ISG15; G1P2; ISG17; UCRP; Ubiquitin-like protein ISG15; Interferon-stimulated gene product 17; Ubiquitin cross-reactive protein; BoUCRP
Species Bos taurus (Bovine)
Expression System E.coli
Tag N-6His
Target Protein Sequence MGGDLTVKMLGGQEILVPLRDSMTVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPLVLQGLRAGSTVLLVVQNCISILVRNDKGRSSPYEVQLKQTVAELKQQVCQKERVQADQFWLSFEGRPMDDEHPLEEYGLMKGCTVFMNLRLRGG
Expression Range 1-154aa
Protein Length Full Length
Mol. Weight 21.4 kDa
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Exhibits antiviral activity towards both DNA and RNA viruses. The secreted form of ISG15 can: induce natural killer cell proliferation, augment lymphokine-activated-killer (LAK) activity, induce dendritic cell maturation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL. In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy.
Subcellular Location Cytoplasm. Secreted.
Database References

KEGG: bta:281871

STRING: 9913.ENSBTAP00000019573

UniGene: PMID: 27165775

  • ISG 15 gene expression is upregulated during 16-18 days of pregnancy and could be used as an early pregnancy marker in dairy cows, especially in heifers. PMID: 27766692
  • ISG15, UBE1l and UBCH8 genes are significantly upregulated in the artificially inseminated pregnant cows. PMID: 27802914
  • Data indicate that the expression profiles of ISG15, MX1, MX2, and OAS1 could be a useful diagnostic biomarker of gestation. PMID: 23384108
  • Bovine herpesvirus 1 protein bICP0 represses the transcription of bISG15 in fetal bovine lung cells. PMID: 22160940
  • ISG15 is an antiviral and inducible protein in bovine immunodeficiency virus infected bovin lung cells. PMID: 20569475
  • ISG15 and conjugated proteins were expressed in corpus luteum of both cyclic and pregnant cows regardless of pregnancy status and were upregulated during early pregnancy PMID: 20172220
  • interferon-stimulated protein(ISG15) was localized throughout the endometrium on day 18-23 of bovine pregnancy and was specifically localized to organelles and compartments of endometrial epithelial cells and stromal cells PMID: 14563704
  • rbovISG15 is unstable over time in storage & dialysis. In vivo, conjugation of ISG15 to targeted proteins occurs inside the cell. PMID: 17223698
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed