Recombinant Bovine Protein S100-B (S100B) Protein (His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06737P
Greater than 90% as determined by SDS-PAGE.
Recombinant Bovine Protein S100-B (S100B) Protein (His-Avi)
Beta LifeScience
SKU/CAT #: BLC-06737P
Collections: Avi-tagged proteins, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bovine Protein S100-B (S100B) Protein (His-Avi) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P02638 |
Target Symbol | S100B |
Species | Bos taurus (Bovine) |
Expression System | E.coli |
Tag | N-6His-Avi |
Target Protein Sequence | SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE |
Expression Range | 2-92aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 13.3 kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity. |
Subcellular Location | Cytoplasm. Nucleus. |
Protein Families | S-100 family |
Database References | |
Tissue Specificity | Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues. |
Gene Functions References
- As CSF-S100B levels in calves with neurologic diseases widely differed, the utility of CSF-S100B as a diagnostic marker for neurologic diseases in cattle remains inconclusive. PMID: 25649061
- S100B might participate in the pathophysiology of brain inflammatory disorders via RAGE-dependent regulation of several inflammation-related events including activation and migration of microglia PMID: 21209080
- X-ray crystallography was used here to characterize an interaction between Ca(2)(+)-S100B and TRTK-12, a target that binds to the p53-binding site on S100B. PMID: 20053360
- Intracellular S100B might modulate myoblast differentiation by interfering with MyoD expression in an NF-kappaB-dependent manner. PMID: 20069545
- S100b activates guanylate cyclase in a calcium-dependent manner [review] PMID: 12596934
- Structural studies in combination with biochemical data are used to develop a model for calcium-induced activation of human nuclear serine/threonine kinase (NDR) kinase by S100B. PMID: 14661952
- S100B shows a sufficient thermostability to resist pasteurization but not spry-drying in milk formulas for preterm and term infants. PMID: 18384096
- Structures of pentamidine (Pnt) bound to Ca(2+)-loaded and Zn(2+),Ca(2+)-loaded S100B were determined by X-ray crystallography at 2.15 A (R(free)=0.266) and 1.85 A (R(free)=0.243) resolution, respectively. PMID: 18602402