Recombinant Bovine Pregnancy-Associated Glycoprotein 2 (PAG2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11046P
Greater than 85% as determined by SDS-PAGE.
Recombinant Bovine Pregnancy-Associated Glycoprotein 2 (PAG2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11046P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bovine Pregnancy-Associated Glycoprotein 2 (PAG2) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q28057 |
| Target Symbol | PAG2 |
| Synonyms | PAG2; Pregnancy-associated glycoprotein 2; PAG 2; EC 3.4.23.- |
| Species | Bos taurus (Bovine) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGPTKLVTNIHKLMNARLENSEYVVSCDAVKTLPPVIFNINGIDYPLRPQAYIIKIQNSCRSVFQGGTENSSLNTWILGDIFLRQYFSVFDRKNRRIGLAPAV |
| Expression Range | 22-376aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 42.1 |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor. |
| Subcellular Location | Secreted, extracellular space. |
| Protein Families | Peptidase A1 family |
| Database References | KEGG: bta:337897 STRING: 9913.ENSBTAP00000016233 UniGene: PMID: 27045629 |
