Recombinant Bovine Interferon Tau-1 (IFNT1) Protein (His)

Name: Recombinant Bovine Interferon Tau-1 (IFNT1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03277P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Bovine Interferon Tau-1 (IFNT1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P15696
Target Symbol	IFNT1
Synonyms	IFNT1; Interferon tau-1; IFN-tau-1; Antiluteolysin; Trophoblast antiluteolytic protein; Trophoblast protein 1; TP-1; Trophoblastin
Species	Bos taurus (Bovine)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL
Expression Range	24-195aa
Protein Length	Full Length of Mature Protein
Mol. Weight	23.8kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.
Subcellular Location	Secreted. Note=Secreted into the uterine lumen.
Protein Families	Alpha/beta interferon family, IFN-alphaII subfamily
Database References	KEGG: bta:317698 STRING: 9913.ENSBTAP00000047689 UniGene: PMID: 29702095 The data suggest that TEAD relocation and/or YAP degradation following its phosphorylation down-regulates IFNT gene transcription after conceptus attachment to the uterine endometrium. PMID: 27315596 Report interferon-tau dependent STAT1 regulation of SOCS genes in bovine endometrium during estrus cycle and embryo implantation. PMID: 25116692 Suggest the involvement of IFNT function within the corpus luteum in the establishment of pregnancy in cows. PMID: 26078085 These results indicate that HB-EGF and its receptors expression changed in bovine endometrium throughout the oestrous cycle; IFN-tau increased their expression in cultured endometrial cells. PMID: 25779761 Data suggest exposure to maternal CSF2 from D5-D7 of development is fundamentally different for female/male blastocysts with respect to embryo elongation, characteristics of transcriptome/methylome, and endometrial interferon tau secretion at D15. PMID: 25078682 as conceptuses attach to the uterine epithelium, IFNT gene transcription is down-regulated by an increase in EOMES expression and EOMES-CREBBP binding in the attached trophoblast cells. PMID: 23606646 Heat shock increased both HSP70 and IFNT expression in blastocysts. PMID: 23638875 The aims of this study were to identify the earliest transcriptional response of the bovine endometrium to the presence of the conceptus and investigate if these genes are regulated by interferon tau (IFNT). PMID: 22759920 Bos taurus (B. T.) Coreanae IFN-tau was cloned from peripheral blood mononuclear cells. The amino acid sequence of B. T. Coreanae IFN-tau shares only 90.3% identity with that of Holstein dairy cow. PMID: 22578803 activity in the early pregnancy endometrium in cattle is modulated by cortisol PMID: 22361386 In a cell culture experiment, interferon-tau stimulated stimulated IL-10 mRNA expression in mononuclear leukocytes and tumor necrosis factor-alpha mRNA levels in neutrophils and eosinophils. PMID: 22052007 In contrast to previous studies in the ovine, granulocyte-macrophage colony-stimulating factor did not increase interferon tau secretion but in agreement with the ovine did not affect bovine blastocyst development. PMID: 20977503 Differentially expressed genes in the endometrial transcriptome are a consequence of IFNT production by the conceptus. PMID: 21349821 The increase in calving rate caused by CSF2 treatment involves, in part, more extensive development of extraembryonic membranes and capacity of the conceptus to secrete IFNT2 at day 15 of pregnancy. PMID: 21339286 investigation of signaling mechanism used by fibroblast growth factor-2 (FGF2) to regulate IFNT production in trophoblasts: several lines of evidence suggest that FGF2 regulates IFNT production in trophoblasts by acting through protein kinase C-delta PMID: 21191110 These data suggest that GATA2/3 is involved in trophoblast-specific regulation of bovine intereron tau gene transcription. PMID: 19598245 During pregnancy, interferon-tau may block ERalpha in the luminal epithelium but likely does not rescue integrin alphavbeta3. expression. PMID: 12756058 Importance of complex Ets-2 enhancer for expression of interferon-tau. Possible means whereby the mother can exert control over conceptus IFN-tau production. PMID: 15217985 The increase in interferon tau concentrations responsible for the maternal recognition of pregnancy results from the increase in embryo size during elongation and not from any upregulation of mRNA expression. PMID: 16435375 FGF-2 stimulates IFNT expression and plays an active role in regulating the establishment and maintenance of pregnancy in ruminants PMID: 16574787 effect of IFN-tau on the proliferation and distribution of peripheral blood lymphocyte subsets during one-way mixed lymphocyte reaction (MLR) in cows and heifers PMID: 16870264 abnormal gene expression of DNMT, INFT, and MHC1 was noted in the majority of cloned embryos, indicating inefficient nuclear reprogramming and retarded embryo development. PMID: 18199878 DLX3 has a central role in controlling IFNT gene expression by associating with ETS2 on the IFNT promoter. PMID: 18322277 Endogenous IFNT transcription in MDBK cells (which do not normally express IFNT) can be induced through CDX2 overexpression and high H3K18 acetylation. PMID: 19211809

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.