Recombinant Bovine Insulin-Like Growth Factor I (IGF1) Protein (hFc)

Name: Recombinant Bovine Insulin-Like Growth Factor I (IGF1) Protein (hFc)
Brand: Beta LifeScience
SKU: BLC-00520P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Bovine Insulin-Like Growth Factor I (IGF1) Protein (hFc) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P07455
Target Symbol	IGF1
Synonyms	(IGF-I)(Somatomedin)
Species	Bos taurus (Bovine)
Expression System	Yeast
Tag	N-hFc
Target Protein Sequence	GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Expression Range	50-119aa
Protein Length	Full Length of Mature Protein
Mol. Weight	34.3 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1.
Subcellular Location	Secreted.
Protein Families	Insulin family
Database References	KEGG: bta:281239 STRING: 9913.ENSBTAP00000055243 UniGene: PMID: 29597124 IGF1/RsaI was associated with average daily weight gain in cattle. PMID: 29023078 Thus CR suppresses the hypertrophic PGC1alpha-4/IGF-1/AKT1 pathway while promoting activation of the calpain system. PMID: 28228415 Data suggest that both ovarian follicular dominance in cows and cooperation of ovarian follicles in pigs can be mediated by either down- or up-regulation of the insulin-like growth factor 1/oxytocin system. PMID: 28163019 IGF1 single nucleotide polymorphisms associated with milk fatty acids in a Chinese Holstein cattle. PMID: 27468856 It has been shown that several specific genes which are differentially regulated, including IGF-1, might impact dairy fertility. PMID: 27514375 There was no association between the genotypes of GH and IGF-IS and fertility of Holstein cows raised in semiextensive or intensive regimes, while the STAT5 ABstEII polymorphism was associated with calving-first heat interval in Holstein cows raised in the intensive system. PMID: 27865414 Associations between genetic variants in the promoter region of the insulin-like growth factor-1 (IGF1) gene and blood serum IGF1 concentration in Hanwoo cattle. PMID: 25966067 The association of IGF1, GH, and PIT1 markers with growth and reproductive traits were assessed. PMID: 25258122 These findings strongly support the concept that IGF-1 upregulates LHR expression in granulosa cells and that IGF-1 is required for determining which follicle becomes dominant and acquires ovulatory capacity. PMID: 25626338 Insulin-induced glucose uptake in lactating bovine mammary epithelial cells may involve the phosphatidylinositide 3-kinase- but not mitogen-activated protein kinase-mediated signaling pathways. PMID: 24731625 Data show that individuals with insulin-like growth factor I (IGF-1) allele C had a significantly higher performance in production traits. PMID: 25177970 Uterine concentrations of IGFBPs are cycle stage specific and also suggests IGF1-dependent and -independent functions for IGFBPs during a time of major change in the developing embryo. PMID: 23607981 This study evaluated the relationship of IGF-I levels to several other determinants of feed intake in Red Angus cross cattle. PMID: 24085409 Production and reproduction traits in Holstein cattle associated with single nucleotide polymorphisms in the IGF1 gene. PMID: 24530703 There is a strong association between putative favorable allelic variants (SNP) of neuropeptide Y, leptin, and IGF-1 genes, and residual feed intake, when animals were grazing on a high-quality, high-availability pasture. PMID: 23881687 Direct additive genetic correlations suggest that selection for greater IGF-I concentration could lead to increased conception rate and calving rate, and decreased age at first calving in heifers. PMID: 23894000 We found that IGF-I stimulated chondrocyte biosynthesis similarly when delivered by either exogenous or endogenous means. PMID: 24105960 Results herein remark the important role of the IGF-1gene in the fertility of dairy cows on early lactation and make the SNP IGF-1/SnaBI an interesting candidate marker for genetic improvement of fertility in dairy cattle. PMID: 23409757 Both the MEK/ERK and PI3K/AKT pathways mediate the stimulatory effect of IGF-I on myoblast proliferation. PMID: 23541948 Polymorphisms associated with IGF1 are linked to reproductive traits in cattle. PMID: 23785023 A significant allele substitution effect was found for IGF1 and yearling weight in Nelore beef cattle. PMID: 23079978 The relationship of postpartum variations of plasma IGF-1 and IGFBP concentrations, oocyte production and quality to parity and subsequent conception rate in Holstein dairy cows is reported. PMID: 22734498 The reduction in IGFs mRNA level after 5 days of life in the duodenum (IGF-1 and IGF-2) and in the jejunum (IGF-1) was associated with reduction in villi length (duodenum and jejunum) and the increase of crypt depth (duodenum). PMID: 22439332 Two IGF-1 SNPs, IGF1i1 and IGF1i2, were significantly associated with body condition score at calving, while a single IGF-1 SNP, IGF1i3, was significantly associated with milk production, including milk yield. PMID: 21948746 GH and IGF-I genotypes had no substantial effect on productive parameters, though IGF-I genotype affected calving-first service interval in primiparous cows. However, the genotypes do alter the endocrine/metabolic profiles of the transition dairy cow. PMID: 21635772 Exogenous recombinant bovine somatotropin did not affect plasma concentrations of IGF-I and insulin, however, it did improve post-thaw sperm membrane integrity. PMID: 19663813 Data describes the long-term changes to skeletal muscle growth and IGF1, 2, 1R, and 2R mRNA expression in progeny after exposure to high and low levels of maternal nutrient intake during the first two trimesters of gestation in the bovine. PMID: 21056085 It was concluded that TGF-alpha and TGF-beta 1, 2 and 3 are present in the testis of the bull calf, and changes in concentrations with age suggest a functional role in the development of the testis. PMID: 19210668 IGF-I gene polymorphism, but not its blood concentration, is associated with milk fat and protein in Holstein dairy cows. PMID: 20812193 analysis of IGF1 gene polymorphisms and their effect on growth traits in Mexican beef cattle PMID: 20467980 IGF-1 and IGF-1r gene polymorphisms in East Anatolian Red and South Anatolian Red cattle breeds. PMID: 20536020 effects of insulin, IGF-I and IGF-II on apoptosis and cell proliferation in bovine blastocysts in vitro PMID: 12112582 Autokinase activity of IGF-IR in esophageal carcinoma cell line can be triggered by the exogenous addition of IGF-I. PMID: 12432233 IGF1 has a role in chondrocyte biosynthesis in cartilage explants PMID: 12781774 Food deprivation-induced decrease in circulating IGF-I in steers is associated with decrease in expression of different IGF-I mRNA variants and specific decrease in expression of growth hormone receptor mRNA variants 1C3 and 1A in liver. PMID: 12888636 Data show that 9-cis-retinoic acid enhanced midkine gene expression, but not insulin-like growth factor-I gene expression, in cumulus-granulosa cells. PMID: 14502603 Concentrations of IGF-I in fetal plasma, as determined by RIA, were significantly higher (P = 0.001) in nuclear transfer pregnancies PMID: 14561651 3 haplotypes with an allele of igf1 showed significant associations with growth traits PMID: 14753343 allele and genotype frequencies of microsatellite markers located in the 5'-regulatory region of the IGF1 and GHR genes in beef cattle and effects of these markers on growth and carcass traits in an intensive production system PMID: 15670132 Plasma IGF-1 level and night plasma melatonin tended (P = 0.10) to be negatively correlated in prepubertal heifers. Light intensities of 10 lx or less had no effect on plasma IGF-1. PMID: 16499558 GH dramatically inhibits the expression of IGFBP-5, and GH along with IGF-I enhanced the phosphorylation of Akt through the reduction of IGF binding protein (IGFBP)-5. PMID: 16698222 GH, IGF-I and IGF-IBP3 regulated the growth and development traits in different growth period. PMID: 16870578 Characterization of single nucleotide polymorphisms in IGF1 in relation to production traits. PMID: 16879354 postweaning serum IGF-I concentration is moderately to highly heritable and has small positive genetic, environmental, and phenotypic correlations with BW other than birth weight and with pre- and postweaning gain PMID: 16908632 IGF-I plays a role in the regulation of folliculogenesis, and may participate in the pathogenesis of cystic ovarian disease in cattle. PMID: 17631370 localized autocrine IGF-I activity might lead to increased permeability via changes in both the tight and adherens junction protein levels PMID: 17668352 results support the hypotheses that IGF1 plays a role in colonic carcinogenesis and that genetically inherited variation in IGF1 expression influences risk of colorectal cancer. PMID: 18308828 IGF-I plays a role in E2- and trenbolone acetate-stimulated proliferation of cultured BSC even in the absence of increased IGF-I expression. PMID: 18403176 delivery of insulin-like growth factor-1 (IGF-1, delivered at concentrations of 0, 10, 50, and 100 ng/mL) affects the endogenous expression of IGF-1, its receptor (IGF-1R), and a well known IGF-1 binding protein (IGFBP-3) by articular chondrocytes PMID: 18491951

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.