Recombinant Bovine Inhibin Alpha Chain (INHA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04061P
Greater than 90% as determined by SDS-PAGE.
Recombinant Bovine Inhibin Alpha Chain (INHA) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04061P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Bovine Inhibin Alpha Chain (INHA) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P07994 |
| Target Symbol | INHA |
| Synonyms | INHA; Inhibin alpha chain |
| Species | Bos taurus (Bovine) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI |
| Expression Range | 227-360aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 30.6kDa |
| Research Area | Others |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. |
| Subcellular Location | Secreted. |
| Protein Families | TGF-beta family |
| Database References | KEGG: bta:281254 STRING: 9913.ENSBTAP00000013154 UniGene: PMID: 27693012 |
