Recombinant Bovine Granulocyte-Macrophage Colony-Stimulating Factor (CSF2) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-07716P

Greater than 90% as determined by SDS-PAGE.
Recombinant Bovine Granulocyte-Macrophage Colony-Stimulating Factor (CSF2) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-07716P
Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Colony-stimulating factors and receptors (csfs), Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Bovine Granulocyte-Macrophage Colony-Stimulating Factor (CSF2) Protein (His-Myc) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P11052 |
Target Symbol | CSF2 |
Synonyms | Colony-stimulating factor Short name: CSF |
Species | Bos taurus (Bovine) |
Expression System | Yeast |
Tag | C-6His-Myc |
Target Protein Sequence | APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK |
Expression Range | 18-143aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 18 kDa |
Research Area | Cytokine |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. |
Subcellular Location | Secreted. |
Protein Families | GM-CSF family |
Database References |
Gene Functions References
- It was concluded that CSF2 can act as a developmental programming agent but alone is not able to abolish the adverse effects of in vitro production on fetal characteristics. PMID: 28379294
- These results demonstrated that bovine colonic cells seem capable to respond to E. bovis merozoite I infection by the upregulation of CXCL10 and GM-CSF gene transcription. PMID: 25982572
- Data suggest exposure to maternal CSF2 from D5-D7 of development is fundamentally different for female/male blastocysts with respect to embryo elongation, characteristics of transcriptome/methylome, and endometrial interferon tau secretion at D15. PMID: 25078682
- inhibits induction of apoptosis in the bovine preimplantation embryo PMID: 21223422
- The increase in calving rate caused by CSF2 treatment involves, in part, more extensive development of extraembryonic membranes and capacity of the conceptus to secrete IFNT2 at day 15 of pregnancy. PMID: 21339286
- immunolocalization studies confirmed the presence of granulocyte-macrophage colony stimulating factor(GM-CSF) in the germ cell line in bovine and human testes and addition of GM-CSF enhances several parameters of sperm motility PMID: 12935848
- the conceptus, through its secretion of IFN-tau, stimulates maternal epithelial expression of COX-2 and GM-CSF during the peri-attachment period in the cow. PMID: 13679318
- CSF2 affect embryonic development and enhance embryo competence for posttransfer survival. PMID: 19797121